PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 403aa    MW: 45214.2 Da    PI: 4.6475
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11450.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.8e-07442537
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                C+ +++k++ lfCe ++  lC  C    H+       H
  PK11450.1  4 LCDFCSSKPALLFCEADSANLCLFCDRRVHSAntlsdkH 42
               6**************************999655555555 PP

2CCT62.31.5e-21354397144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R +a+lRYkeK+ktR+++K+irYe+RKa+A++R RvKGrF k++
  PK11450.1 354 RGNAMLRYKEKKKTRRYDKHIRYETRKARADTRERVKGRFIKST 397
                7789*************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.03147IPR000315B-box-type zinc finger
SMARTSM003366.2E-10147IPR000315B-box-type zinc finger
PfamPF006438.0E-6443IPR000315B-box-type zinc finger
CDDcd000211.81E-7447No hitNo description
PROSITE profilePS5101714.823354396IPR010402CCT domain
PfamPF062034.0E-16354396IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MFSLCDFCSS KPALLFCEAD SANLCLFCDR RVHSANTLSD KHSRSWICHN CGLNPVSVVC  60
SKNKVLLCHD CNWDSHTNCS ISCLNELTSV EVFSGCPSAS GLASFLGLNL ESENSVDLSS  120
GSDQIQQKFF VSSDDGSSAT LKRRNELCEQ LIEMGKKDLL RVDVDVAQMR PRTPPSRCSQ  180
QENIDGLVGQ KTDGDELRHE TSFASSVVLP TSLDLKQGDS VAEEDHLWDY NHTYDSSLIW  240
HFQLEDSKDC EESCSEITEI NNPCSLVTPK YEVSTIYEDT LSENDQLLSN YASQLGENTN  300
DQSLGFETEM DLDIPEGCNS PSYVQDSGHE ILPMSDPTKG SKSMMEMEMQ AQNRGNAMLR  360
YKEKKKTRRY DKHIRYETRK ARADTRERVK GRFIKSTEAS NDA
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47372843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.14e-58B-box type zinc finger protein with CCT domain